New User Special Price Expires in

Let's log you in.

Sign in with Facebook


Don't have a StudySoup account? Create one here!


Create a StudySoup account

Be part of our community, it's free to join!

Sign up with Facebook


Create your account
By creating an account you agree to StudySoup's terms and conditions and privacy policy

Already have a StudySoup account? Login here

Introduction to Organic Chemistry I

by: Prince Terry

Introduction to Organic Chemistry I CHEM 261

Marketplace > University of North Carolina - Chapel Hill > Chemistry > CHEM 261 > Introduction to Organic Chemistry I
Prince Terry
GPA 3.52


Almost Ready


These notes were just uploaded, and will be ready to view shortly.

Purchase these notes here, or revisit this page.

Either way, we'll remind you when they're ready :)

Preview These Notes for FREE

Get a free preview of these Notes, just enter your email below.

Unlock Preview
Unlock Preview

Preview these materials now for free

Why put in your email? Get access to more of this material and other relevant free materials for your school

View Preview

About this Document

Class Notes
25 ?




Popular in Course

Popular in Chemistry

This 4 page Class Notes was uploaded by Prince Terry on Sunday October 25, 2015. The Class Notes belongs to CHEM 261 at University of North Carolina - Chapel Hill taught by Staff in Fall. Since its upload, it has received 8 views. For similar materials see /class/228858/chem-261-university-of-north-carolina-chapel-hill in Chemistry at University of North Carolina - Chapel Hill.


Reviews for Introduction to Organic Chemistry I


Report this Material


What is Karma?


Karma is the currency of StudySoup.

You can buy or earn more Karma at anytime and redeem it for class notes, study guides, flashcards, and more!

Date Created: 10/25/15
Principles of data organization Example of a Genbank entry Locus DEFINITION ACCE ssIoN REFERENCE AUTHORS TITLE JOURNAL NEDLINE character VIEHALUXA 3141 bp DNA ECT lErE E 9 e Vharvey1 luclferase alpha and beta subunit luxA and 1ux8 genes FEATURES gene 05 a m a Eu n e ubacterla Proteobacterla gamma subdiVision Vibrlonaceae Vibrlo 1 bases 1 to 1838 hnDHNi1ehamAJ SimonNI Nea1soniltix RauschSK 8 amp and 8a1dWinTo Nucieotide sequence of the luxA gene of Vibrlo harveyl and the compiete amino acid sequence of the aipha subunit of bacterlal ta 8 8ioi chem ZED 18 613976146 1985 5 1 Johnstonrc ThompsonRE and EaldwlnTO Nucieotide sequence of the luxE gene of Vibrlo harveyl and the compiete amino 1 ase J 8ioi chem 261 11 48854811 1986 Database Organization EASE COUNT ORIGIN acid sequence of the beta subunit of bacterlal 121 qttatctctq atctq qaqc tt a g 181 qacacactaq aaaaachct tqgttttqat tacctcaqtt tgcctatha tqaqctacca D D Applicalinn pmglzms Database a collection of related structured information about entities a collection of records a set of fields a single characteristic of an entity a symbol used in data field Example of a Genbank entry Location Quallflers 1774 787 genequotluxAquot 7 87 1774 translat10n quotMKE GNE LLTYQPPELSQTEWKRLVNLGKASEGCGFDTVWLLEH EIIASMKLFQSDWPYLKEKQquot e c 741 g 852 t om mm p upstream ECORI site qaattcacca tqacgacng caaaaataqt ttgtqcactq tttatcactq qctqcagacc tgg cttqattch qcaaqtctct caqctcgtqt cqcctatqaa t gtc ttctq ttactgcqq ttqqtqtgqt qaactt cqt Database Management Sy stem DBMS SI39IIIgI39Iizi 22111 a ialabasz SEIZ Endrusevs Four major components of DBMS Data Hardware Software Users Data MOdel DNA vs Protein searches A named logical unit record type data item 0 Relationships among logical unis DNA sequence Relationships among logical units one to one 0 one to many 0 many to one Protein database Database administration DNA sequence DNA database 0 Redundancy eliminated Inconsistency avoided 0 larger databases Data Shared more random his Standards enforced simpler scoring functions security applied 0 missing his similar proteins Integrity majmmhed encoded by different DNAs Requirements balanced Data Warehouse Data Mlng 0 Data mining is the exploration and analysis by automatic or semiautomatic means of large quantities of data in order to discover 1 meaningful patterns and rules 0 Common data mining tasks 7 Classi cation 1 7 Prediction 7 Af nity Grouping 7 Clustering 7 Description Knowledge Discovery Knowledge Discova39y umme mmmummm 7mm m Pmmmmmm 9 mm rPll39pose Eprmvahu arson Bald mums Mehd CM an 45mquot 9mm on m cxmswmrmkmmmm Mechd We sew k hlgeu39mldbased on mquot n m Wm m mdau mm mm gmmhwmwmgmmm m mwmmm modding m 5mm Classi cation mamaquot mm qp mmmpmme 39 m u m V V i m h q a We 5 n 5 Estimation Af nity Grouping gm chaunmmcs Panem visualization Clustenng WW am WWW mm 9 s 1n mm M m m mama mm mm mph mm m was Wk by mm mm 12 gm mm snaga my mm 5ny


Buy Material

Are you sure you want to buy this material for

25 Karma

Buy Material

BOOM! Enjoy Your Free Notes!

We've added these Notes to your profile, click here to view them now.


You're already Subscribed!

Looks like you've already subscribed to StudySoup, you won't need to purchase another subscription to get this material. To access this material simply click 'View Full Document'

Why people love StudySoup

Jim McGreen Ohio University

"Knowing I can count on the Elite Notetaker in my class allows me to focus on what the professor is saying instead of just scribbling notes the whole time and falling behind."

Jennifer McGill UCSF Med School

"Selling my MCAT study guides and notes has been a great source of side revenue while I'm in school. Some months I'm making over $500! Plus, it makes me happy knowing that I'm helping future med students with their MCAT."

Bentley McCaw University of Florida

"I was shooting for a perfect 4.0 GPA this semester. Having StudySoup as a study aid was critical to helping me achieve my goal...and I nailed it!"


"Their 'Elite Notetakers' are making over $1,200/month in sales by creating high quality content that helps their classmates in a time of need."

Become an Elite Notetaker and start selling your notes online!

Refund Policy


All subscriptions to StudySoup are paid in full at the time of subscribing. To change your credit card information or to cancel your subscription, go to "Edit Settings". All credit card information will be available there. If you should decide to cancel your subscription, it will continue to be valid until the next payment period, as all payments for the current period were made in advance. For special circumstances, please email


StudySoup has more than 1 million course-specific study resources to help students study smarter. If you’re having trouble finding what you’re looking for, our customer support team can help you find what you need! Feel free to contact them here:

Recurring Subscriptions: If you have canceled your recurring subscription on the day of renewal and have not downloaded any documents, you may request a refund by submitting an email to

Satisfaction Guarantee: If you’re not satisfied with your subscription, you can contact us for further help. Contact must be made within 3 business days of your subscription purchase and your refund request will be subject for review.

Please Note: Refunds can never be provided more than 30 days after the initial purchase date regardless of your activity on the site.